Skip to content

ESM-2 Optimized with NVIDIA TransformerEngine

This folder contains source code and tests for an ESM-2 model that inherits from the transformers PreTrainedModel class and uses TransformerEngine layers. Users don't need to install this package directly, but can load the model directly from HuggingFace Hub using the standard transformers API (see Inference Examples below).

Feature support

The ESM-2 implementation natively supports the following TransformerEngine-provided optimizations:

Feature Support
FP8 ✅ Supported on compute capacity 9.0 and above (Hopper+)
MXFP8 ✅ Supported on compute capacity 10.0 and 10.3 (Blackwell), 12.0 support pending
Sequence Packing / THD input format ✅ Supported
FP8 with THD input format ✅ Supported where FP8 is supported
Import from HuggingFace checkpoints ✅ Supported
Export to HuggingFace checkpoints ✅ Supported

See BioNemo Recipes for more details on how to use these features to accelerate model training and inference.

Pre-trained ESM-2 models converted from the original Facebook weights are available on HuggingFace as part of the NVIDIA BioNeMo collection on the HuggingFace Hub:

Available Models:

Runtime Requirements

We recommend using the latest NVIDIA PyTorch container for optimal performance and compatibility. See the provided Dockerfile for details.

Inference Examples

Quick start example using HuggingFace transformers:

from transformers import AutoModel, AutoTokenizer

model = AutoModel.from_pretrained("nvidia/esm2_t6_8M_UR50D")
tokenizer = AutoTokenizer.from_pretrained("nvidia/esm2_t6_8M_UR50D")

gfp_P42212 = (
    "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL"
    "VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV"
    "NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD"
    "HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"
)

inputs = tokenizer(gfp_P42212, return_tensors="pt")
output = model(**inputs)

Training recipes are available in the bionemo-recipes/recipes/ directory:

Converting Between Model Formats

This section explains how to convert between Hugging Face Transformers and Transformer Engine (TE) ESM2 model formats. The process demonstrates bidirectional conversion: from Transformers to TE format for optimized inference, and back to Hugging Face Transformers format for sharing and deployment. The workflow involves several key steps:

Converting from HF Transformers to TE

from transformers import AutoModelForMaskedLM

from esm.convert import convert_esm_hf_to_te

hf_model = AutoModelForMaskedLM.from_pretrained("facebook/esm2_t6_8M_UR50D")
te_model = convert_esm_hf_to_te(hf_model)
te_model.save_pretrained("/path/to/te_checkpoint")

This loads the pre-trained ESM2 model that will serve as our reference for comparison.

Converting from TE back to HF Transformers

from esm.convert import convert_esm_te_to_hf
from esm.modeling_esm_te import NVEsmForMaskedLM

te_model = NVEsmForMaskedLM.from_pretrained("/path/to/te_checkpoint")
hf_model = convert_esm_te_to_hf(te_model)
hf_model.save_pretrained("/path/to/hf_checkpoint")

Load and Test the Exported Model

Load the exported model and perform validation:

from transformers import AutoTokenizer

model_hf_exported = AutoModelForMaskedLM.from_pretrained("/path/to/hf_checkpoint")
tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t6_8M_UR50D")

Validating Converted Models

See the commands in Inference Examples above to load and test both the original and converted models to ensure loss and logit values are similar. See also the golden value tests in test_modeling_esm_te.py and test_convert.py.

Developer Guide

Running tests

To run tests locally, run recipes_local_test.py from the repository root with the model directory as an argument.

./ci/scripts/recipes_local_test.py bionemo-recipes/models/esm2/

Development container

To use the provided devcontainer, use "Dev Containers: Reopen in Container" from the VSCode menu, and choose the "BioNeMo Recipes Dev Container" option. To run the tests inside the container, first install the model package in editable mode with pip install -e ., then run pytest -v . in the model directory.

Deploying converted checkpoints to HuggingFace Hub

First, generate converted ESM-2 checkpoints from existing HuggingFace transformers checkpoints:

mkdir -p checkpoint_export
docker build -t esm2 .
docker run --rm -it --gpus all \
  -v $PWD/checkpoint_export/:/workspace/bionemo/checkpoint_export \
  -v $HOME/.cache/huggingface/:/root/.cache/huggingface \
  esm2 python export.py

Now deploy the converted checkpoints to the HuggingFace Hub by running the following command for each model:

huggingface-cli upload nvidia/${MODEL_NAME} $PWD/checkpoint_export/${MODEL_NAME}

Or, upload all models at once with:

cd checkpoint_export
for dir in */; do hf upload --repo-type model nvidia/$(basename "$dir") "$dir/"; done