ESM-2 Optimized with NVIDIA TransformerEngine
This folder contains source code and tests for an ESM-2 model that inherits from the transformers PreTrainedModel
class and uses TransformerEngine layers. Users don't need to install this package directly, but can load the
model directly from HuggingFace Hub using the standard transformers API (see Inference Examples
below).
Feature support
The ESM-2 implementation natively supports the following TransformerEngine-provided optimizations:
| Feature | Support |
|---|---|
| FP8 | ✅ Supported on compute capacity 9.0 and above (Hopper+) |
| MXFP8 | ✅ Supported on compute capacity 10.0 and 10.3 (Blackwell), 12.0 support pending |
| Sequence Packing / THD input format | ✅ Supported |
| FP8 with THD input format | ✅ Supported where FP8 is supported |
| Import from HuggingFace checkpoints | ✅ Supported |
| Export to HuggingFace checkpoints | ✅ Supported |
See BioNemo Recipes for more details on how to use these features to accelerate model training and inference.
Links to HF checkpoints
Pre-trained ESM-2 models converted from the original Facebook weights are available on HuggingFace as part of the NVIDIA BioNeMo collection on the HuggingFace Hub:
Available Models:
nvidia/esm2_t6_8M_UR50D(8M parameters)nvidia/esm2_t12_35M_UR50D(35M parameters)nvidia/esm2_t30_150M_UR50D(150M parameters)nvidia/esm2_t33_650M_UR50D(650M parameters)nvidia/esm2_t36_3B_UR50D(3B parameters)nvidia/esm2_t48_15B_UR50D(15B parameters)
Runtime Requirements
We recommend using the latest NVIDIA PyTorch container for optimal performance and compatibility. See the provided Dockerfile for details.
Inference Examples
Quick start example using HuggingFace transformers:
from transformers import AutoModel, AutoTokenizer
model = AutoModel.from_pretrained("nvidia/esm2_t6_8M_UR50D")
tokenizer = AutoTokenizer.from_pretrained("nvidia/esm2_t6_8M_UR50D")
gfp_P42212 = (
"MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL"
"VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV"
"NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD"
"HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"
)
inputs = tokenizer(gfp_P42212, return_tensors="pt")
output = model(**inputs)
Recipe Links
Training recipes are available in the bionemo-recipes/recipes/ directory:
- esm2_native_te - Demonstrates training with a simple native PyTorch training loop.
- esm2_accelerate_te - Trains the model using HuggingFace Accelerate.
Converting Between Model Formats
This section explains how to convert between Hugging Face Transformers and Transformer Engine (TE) ESM2 model formats. The process demonstrates bidirectional conversion: from Transformers to TE format for optimized inference, and back to Hugging Face Transformers format for sharing and deployment. The workflow involves several key steps:
Converting from HF Transformers to TE
from transformers import AutoModelForMaskedLM
from esm.convert import convert_esm_hf_to_te
hf_model = AutoModelForMaskedLM.from_pretrained("facebook/esm2_t6_8M_UR50D")
te_model = convert_esm_hf_to_te(hf_model)
te_model.save_pretrained("/path/to/te_checkpoint")
This loads the pre-trained ESM2 model that will serve as our reference for comparison.
Converting from TE back to HF Transformers
from esm.convert import convert_esm_te_to_hf
from esm.modeling_esm_te import NVEsmForMaskedLM
te_model = NVEsmForMaskedLM.from_pretrained("/path/to/te_checkpoint")
hf_model = convert_esm_te_to_hf(te_model)
hf_model.save_pretrained("/path/to/hf_checkpoint")
Load and Test the Exported Model
Load the exported model and perform validation:
from transformers import AutoTokenizer
model_hf_exported = AutoModelForMaskedLM.from_pretrained("/path/to/hf_checkpoint")
tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t6_8M_UR50D")
Validating Converted Models
See the commands in Inference Examples above to load and test both the original and converted models to ensure loss and logit values are similar. See also the golden value tests in test_modeling_esm_te.py and test_convert.py.
Developer Guide
Running tests
To run tests locally, run recipes_local_test.py from the repository root with the model directory as an argument.
./ci/scripts/recipes_local_test.py bionemo-recipes/models/esm2/
Development container
To use the provided devcontainer, use "Dev Containers: Reopen in Container" from the VSCode menu, and choose the
"BioNeMo Recipes Dev Container" option. To run the tests inside the container, first install the model package in
editable mode with pip install -e ., then run pytest -v . in the model directory.
Deploying converted checkpoints to HuggingFace Hub
First, generate converted ESM-2 checkpoints from existing HuggingFace transformers checkpoints:
mkdir -p checkpoint_export
docker build -t esm2 .
docker run --rm -it --gpus all \
-v $PWD/checkpoint_export/:/workspace/bionemo/checkpoint_export \
-v $HOME/.cache/huggingface/:/root/.cache/huggingface \
esm2 python export.py
Now deploy the converted checkpoints to the HuggingFace Hub by running the following command for each model:
huggingface-cli upload nvidia/${MODEL_NAME} $PWD/checkpoint_export/${MODEL_NAME}
Or, upload all models at once with:
cd checkpoint_export
for dir in */; do hf upload --repo-type model nvidia/$(basename "$dir") "$dir/"; done