ESM-2 Fine-Tuning
This readme serves as a demo for implementing ESM-2 Fine-tuning module, running a regression example and using the model for inference.
The ESM-2 model is a transformer-based protein language model that has achieved state-of-the-art results in various protein-related tasks. When fine-tuning ESM2, the task head plays a crucial role. A task head refers to the additional layer or set of layers added on top of a pre-trained model, like the ESM-2 transformer-based protein language model, to adapt it for a specific downstream task. As a part of transfer learning, a pre-trained model is often utilized to learn generic features from a large-scale dataset. However, these features might not be directly applicable to the specific task at hand. By incorporating a task head, which consists of learnable parameters, the model can adapt and specialize to the target task. The task head serves as a flexible and adaptable component that learns task-specific representations by leveraging the pre-trained features as a foundation. Through fine-tuning, the task head enables the model to learn and extract task-specific patterns, improving performance and addressing the nuances of the downstream task. It acts as a critical bridge between the pre-trained model and the specific task, enabling efficient and effective transfer of knowledge.
Setup and Assumptions
In this tutorial, we will demonstrate how to create a fine-tune module, train a regression task head, and use the fine-tuned model for inference.
All commands should be executed inside the BioNeMo docker container, which has all ESM-2 dependencies pre-installed. This tutorial assumes that a copy of the BioNeMo framework repo exists on workstation or server and has been mounted inside the container at /workspace/bionemo2. (Note: This WORKDIR may be /workspaces/bionemo-framework if you are using the VSCode Dev Container.) For more information on how to build or pull the BioNeMo2 container, refer to the Access and Startup.
To successfully accomplish this we need to define some key classes:
- Loss Reduction Method - To compute the supervised fine-tuning loss.
- Fine-Tuned Model Head - Downstream task head model.
- Fine-Tuned Model - Model that combines ESM-2 with the task head model.
- Fine-Tuning Config - Configures the fine-tuning model and loss to use in the training and inference framework.
- Dataset - Training and inference datasets for ESM2.
1 - Loss Reduction Class
A class for calculating the supervised loss of the fine-tune model from targets. We inherit from Megatron Bert Masked Language Model Loss (BERTMLMLossWithReduction) and override the forward() pass to compute MSE loss of the regression head within a micro-batch. The reduce() method is used for computing the average over the micro-batches and is only used for logging.
class RegressorLossReduction(BERTMLMLossWithReduction):
def forward(
self, batch: Dict[str, torch.Tensor], forward_out: Dict[str, torch.Tensor]
) -> Tuple[torch.Tensor, Union[PerTokenLossDict, SameSizeLossDict]]:
targets = batch["labels"] # [b, 1]
regression_output = forward_out
loss = torch.nn.functional.mse_loss(regression_output, targets)
return loss, {"avg": loss}
def reduce(self, losses_reduced_per_micro_batch: Sequence[ReductionT]) -> torch.Tensor:
losses = torch.stack([loss["avg"] for loss in losses_reduced_per_micro_batch])
return losses.mean()
2 - Fine-Tuned Model Head
An MLP class for sequence-level regression. This class inherits MegatronModule and uses the fine-tune config (TransformerConfig) to configure the regression head for the fine-tuned ESM-2 model.
class MegatronMLPHead(MegatronModule):
def __init__(self, config: TransformerConfig):
super().__init__(config)
layer_sizes = [config.hidden_size, 256, 1]
self.linear_layers = torch.nn.ModuleList(
[torch.nn.Linear(i, o) for i, o in zip(layer_sizes[:-1], layer_sizes[1:])]
)
self.act = torch.nn.ReLU()
self.dropout = torch.nn.Dropout(p=config.ft_dropout)
def forward(self, hidden_states: torch.Tensor) -> List[torch.Tensor]:
...
3 - Fine-Tuned Model
A fine-tuned ESM-2 model class for token classification tasks. This class inherits from the ESM2Model class and adds the custom regression head MegatronMLPHead the we created in the previous step. Optionally one can freeze all or parts of the encoder by parsing through the model parameters in the model constructor.
class ESM2FineTuneSeqModel(ESM2Model):
def __init__(self, config, *args, post_process: bool = True, return_embeddings: bool = False, **kwargs):
super().__init__(config, *args, post_process=post_process, return_embeddings=True, **kwargs)
# freeze encoder parameters
if config.encoder_frozen:
for _, param in self.named_parameters():
param.requires_grad = False
if post_process:
self.regression_head = MegatronMLPHead(config)
def forward(self, *args, **kwargs,):
output = super().forward(*args, **kwargs)
...
regression_output = self.regression_head(embeddings)
return regression_output
4 - Fine-Tuning Config
A dataclass that configures the fine-tuned ESM-2 model. In this example ESM2FineTuneSeqConfig inherits from ESM2GenericConfig and adds custom arguments to setup the fine-tuned model. The configure_model() method of this dataclass is called within the Lightning module to call the model constructor with the dataclass arguments.
The common arguments among different fine-tuning tasks are
model_cls: The fine-tune model class (ESM2FineTuneSeqModel)initial_ckpt_path: BioNeMo 2.0 ESM-2 pre-trained checkpointinitial_ckpt_skip_keys_with_these_prefixes: skip keys when loading parameters from a checkpoint. Here we should not look forregression_headin the pre-trained checkpoint.get_loss_reduction_class(): Implements selection of the appropriateMegatronLossReductionclass, e.g.bionemo.esm2.model.finetune.finetune_regressor.RegressorLossReduction.
@dataclass
class ESM2FineTuneSeqConfig(ESM2GenericConfig[ESM2FineTuneSeqModel], iom.IOMixinWithGettersSetters):
model_cls: Type[ESM2FineTuneSeqModel] = ESM2FineTuneSeqModel
# The following checkpoint path is for nemo2 checkpoints. Config parameters not present in
# self.override_parent_fields will be loaded from the checkpoint and override those values here.
initial_ckpt_path: str | None = None
# typical case is fine-tune the base biobert that doesn't have this head. If you are instead loading a checkpoint
# that has this new head and want to keep using these weights, please drop this next line or set to []
initial_ckpt_skip_keys_with_these_prefixes: List[str] = field(default_factory=lambda: ["regression_head"])
encoder_frozen: bool = True # freeze encoder parameters
ft_dropout: float = 0.25 # MLP layer dropout
def get_loss_reduction_class(self) -> Type[MegatronLossReduction]:
return RegressorLossReduction
5 - Dataset
We will use a sample dataset for demonstration purposes. Create a dataset class by extending from torch.utils.data.Dataset. For the purposes of this demo, we'll assume dataset consists of small set of protein sequences with a target value of len(sequence) / 100.0 as their labels.
data = [
("MVLSPADKTNVKAAWGKVGAHAGEYGAEALERH", 0.33),
...
]
Therefore, the custom BioNeMo dataset class will be appropriate (found in bionemo.esm2.model.finetune.finetune_regressor.InMemorySingleValueDataset) as it facilitates predicting on a single value. An excerpt from the class is shown below. This example dataset expected a sequence of Tuple that hold (sequence, target) values. However, one can simply extend InMemorySingleValueDataset class in a similar way to customize your class for your data.
class InMemorySingleValueDataset(Dataset):
def __init__(
self,
data: Sequence[Tuple[str, float]],
tokenizer: tokenizer.BioNeMoESMTokenizer = tokenizer.get_tokenizer(),
seed: int = np.random.SeedSequence().entropy,
):
For any arbitrary data file formats, user can process the data into a list of tuples containing (sequence, label) and use this dataset class. Or override the dataset class to load their custom data files.
To coordinate the creation of training, validation and testing datasets from your data, we need to use a datamodule class. To do this we can directly use or extend the ESM2FineTuneDataModule class (located at bionemo.esm2.model.finetune.datamodule.ESM2FineTuneDataModule) which defines helpful abstract methods that use your dataset class.
dataset = InMemorySingleValueDataset(data)
data_module = ESM2FineTuneDataModule(
train_dataset=train_dataset,
valid_dataset=valid_dataset
micro_batch_size=4, # size of a batch to be processed in a device
global_batch_size=8, # size of batch across all devices. Should be multiple of micro_batch_size
)
Fine-Tuning the Regressor Task Head for ESM2
Now we can put these five requirements together to fine-tune a regressor task head starting from a pre-trained ESM-2 model (pretrain_ckpt_path). We can take advantage of a simple training loop in bionemo.esm2.model.fnetune.train and use the `train_model() function to start the fine-tuning process in the following.
# create a List[Tuple] with (sequence, target) values
artificial_sequence_data = [
"TLILGWSDKLGSLLNQLAIANESLGGGTIAVMAERDKEDMELDIGKMEFDFKGTSVI",
"LYSGDHSTQGARFLRDLAENTGRAEYELLSLF",
"GRFNVWLGGNESKIRQVLKAVKEIGVSPTLFAVYEKN",
"DELTALGGLLHDIGKPVQRAGLYSGDHSTQGARFLRDLAENTGRAEYELLSLF",
"KLGSLLNQLAIANESLGGGTIAVMAERDKEDMELDIGKMEFDFKGTSVI",
"LFGAIGNAISAIHGQSAVEELVDAFVGGARISSAFPYSGDTYYLPKP",
"LGGLLHDIGKPVQRAGLYSGDHSTQGARFLRDLAENTGRAEYELLSLF",
"LYSGDHSTQGARFLRDLAENTGRAEYELLSLF",
"ISAIHGQSAVEELVDAFVGGARISSAFPYSGDTYYLPKP",
"SGSKASSDSQDANQCCTSCEDNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRSTGPAKT",
]
data = [(seq, len(seq)/100.0) for seq in artificial_sequence_data]
# we are training and validating on the same dataset for simplicity
dataset = InMemorySingleValueDataset(data)
data_module = ESM2FineTuneDataModule(train_dataset=dataset, valid_dataset=dataset)
with tempfile.TemporaryDirectory() as experiment_tempdir_name:
experiment_dir = Path(experiment_tempdir_name)
experiment_name = "finetune_regressor"
n_steps_train = 50
seed = 42
config = ESM2FineTuneSeqConfig(
# initial_ckpt_path=str(pretrain_ckpt_path)
)
checkpoint, metrics, trainer = train_model(
experiment_name=experiment_name,
experiment_dir=experiment_dir, # new checkpoint will land in a subdir of this
config=config, # same config as before since we are just continuing training
data_module=data_module,
n_steps_train=n_steps_train,
)
This example is fully implemented in bionemo.esm2.model.finetune.train and can be executed by:
python /workspace/bionemo2/sub-packages/bionemo-esm2/src/bionemo/esm2/model/finetune/train.py
Notes
- The above example is fine-tuning a randomly initialized ESM-2 model for demonstration purposes. In order to fine-tune a pre-trained ESM-2 model, please download the ESM-2 650M checkpoint from NGC resources using the following bash command
and pass the output path (e.g.
download_bionemo_data esm2/650m:2.0 --source ngc.../.cache/bionemo/975d29ee980fcb08c97401bbdfdcf8ce-esm2_650M_nemo2.tar.gz.untar) as an argument intoinitial_ckpt_pathwhile setting the config object:config = ESM2FineTuneSeqConfig( initial_ckpt_path=str(pretrain_ckpt_path) ) - Due to Megatron limitations, the log produced by the training run iterates on steps/iterations and not epochs. Therefore,
Training epochcounter stays at value zero whileiterationandglobal_step increase during the course of training (example in the following).to achieve the same epoch-based effect while training, please choose the number of training steps (Training epoch 0, iteration <x/max_steps> | ... | global_step: <x> | reduced_train_loss: ... | val_loss: ...n_steps_train) so that:n_steps_train * global_batch_size = len(dataset) * desired_num_epochs - We are using a small dataset of artificial sequences as our fine-tuning data in this example. You may experience over-fitting and observe no change in the validation metrics.
Fine-Tuned ESM-2 Model Inference
Once we have a checkpoint we can create a config object by pointing the path in initial_ckpt_path and use that for inference. Since we need to load all the parameters from this checkpoint (and don't skip the head) we reset the nitial_ckpt_skip_keys_with_these_prefixes in this config. Now we can use the bionemo.esm2.model.fnetune.train.infer to run inference on prediction dataset.
config = ESM2FineTuneSeqConfig(
initial_ckpt_path = finetuned_checkpoint,
initial_ckpt_skip_keys_with_these_prefixes: List[str] = field(default_factory=list)
)
This example is implemented in bionemo.esm2.model.finetune.infer and can be executed by:
python /workspace/bionemo2/sub-packages/bionemo-esm2/src/bionemo/esm2/model/finetune/infer.py
Notes
- For demonstration purposes, executing the above command will infer a randomly initialized
ESM2FineTuneSeqModelunlessinitial_ckpt_pathis specified and set to an already trained model. - If a fine-tuned checkpoint is provided as (
initial_ckpt_path) theinitial_ckpt_skip_keys_with_these_prefixesshould reset tofield(default_factory=list)and avoid skipping any parameters.