Skip to content

AMPLIFY Optimized with NVIDIA TransformerEngine

This folder contains source code and tests for an AMPLIFY model that inherits from the transformers PreTrainedModel class and uses TransformerEngine layers. Users don't need to install this package directly, but can load the model directly from HuggingFace Hub using the standard transformers API (see Inference Examples below).

Feature support

The AMPLIFY implementation natively supports the following TransformerEngine-provided optimizations:

Feature Support
FP8 🚧 Under development
MXFP8 ❌ Not currently supported
Sequence Packing / THD input format 🚧 Under development
FP8 with THD input format 🚧 Under development
Import from HuggingFace checkpoints ✅ Supported
Export to HuggingFace checkpoints 🚧 Under development

See BioNeMo Recipes for more details on how to use these features to accelerate model training and inference.

Pre-trained AMPLIFY models are available on HuggingFace as part of the NVIDIA BioNeMo collection on the HuggingFace Hub:

Available Models:

Runtime Requirements

We recommend using the latest NVIDIA PyTorch container for optimal performance and compatibility. See the provided Dockerfile for details.

Inference Examples

Quick start example using HuggingFace transformers:

from transformers import AutoModel, AutoTokenizer

model = AutoModel.from_pretrained("nvidia/AMPLIFY_120M")
tokenizer = AutoTokenizer.from_pretrained("nvidia/AMPLIFY_120M")

# Example protein sequence
protein_sequence = (
    "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL"
    "VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV"
    "NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD"
    "HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"
)

inputs = tokenizer(protein_sequence, return_tensors="pt")
output = model(**inputs)

Training recipes are available in the bionemo-recipes/recipes/ directory. AMPLIFY can be trained using the same recipes as ESM-2, simply by switching the model_tag to reference the AMPLIFY model, e.g. nvidia/AMPLIFY_120M, and changing the dataset as appropriate.

Commands for converting checkpoints

HF Transformers to TE conversion

Generate converted AMPLIFY checkpoints from existing HuggingFace transformers checkpoints:

mkdir -p checkpoint_export
docker build -t amplify .
docker run --rm -it --gpus all \
  -v $PWD/checkpoint_export/:/workspace/bionemo/checkpoint_export \
  -v $HOME/.cache/huggingface/:/root/.cache/huggingface \
  amplify python export.py

TE to HF Transformers conversion

(Coming soon)

Developer Guide

Running tests

To run tests locally, run recipes_local_test.py from the repository root with the model directory as an argument.

./ci/scripts/recipes_local_test.py bionemo-recipes/models/amplify/

Development container

To use the provided devcontainer, use "Dev Containers: Reopen in Container" from the VSCode menu, and choose the "BioNeMo Recipes Dev Container" option. To run the tests inside the container, first install the model package in editable mode with pip install -e ., then run pytest -v . in the model directory.

Deploying converted checkpoints to HuggingFace Hub

After running the checkpoint conversion steps listed in Commands for converting checkpoints, you can deploy the converted checkpoints to the HuggingFace Hub by running the following command:

huggingface-cli upload nvidia/${MODEL_NAME} $PWD/checkpoint_export/${MODEL_NAME}

Or, upload all models at once with:

for dir in *; do huggingface-cli upload nvidia/$(basename "$dir") "$dir/"; done