Inference with NVIDIA Triton Inference Server
Contents
Inference with NVIDIA Triton Inference Server#
This section will use the pre-trained BioNeMo checkpoints to demonstrate NVIDIA Triton Inference Server. PyTriton, which is a Flask/FastAPI-like interface that simplifies Triton deployment in Python environments will be used.
Prerequisites#
Linux OS
Pascal, Volta, Turing, or an NVIDIA Ampere architecture-based GPU.
NVIDIA Driver
Docker
Detailed Example with ESM-1nv#
PyTriton provides a light-weight wrapper that allows you to set up the Triton Inference Server based on existing inference code. The only requirement is that inference is done by a function, that takes as an input and returns numpy arrays of supported types (numerical types or bytes).
In this example, the Sequence to Embedding task for ESM1 will be used as an example. The solution will consist of two components - server that performs the inference, and a client that queries this server.
The bionemo.model.protein.esm1nv.infer.ESM1nvInference
class provides seq_to_embeddings
method that can be used for this purpose. This method requires a list of FASTA sequences as input (list of strings) and returns a torch Tensor object as a result, so a converter must be implemented.
On the client side, a function that takes list of sequences as input and converts it into a numpy bytes array must be implemented:
import numpy as np
sequences = ['MSLKRKNIALIPAAGIGVRFGADKPKQYVEIGSKTVLEHVL', 'MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLA']
sequences = np.array([[seq] for seq in sequences])
sequences = np.char.encode(sequences, "utf-8")
On the server side, an inference callable that performs the following must be implemented:
accepted input in a supported format (numpy bytes array)
decodes it to a list of strings
runs inference with the pre-trained BioNeMo model (for example, ESM1)
converts output to a supported format
and sends it back to the client
Mark this callable with the @batch
decorator from PyTriton. This decorator converts the input request into a more suitable format that can be directly passed to the model (refer to more details on batch decorator in the PyTrtion documentation).
An example inference callable is provided below:
import numpy as np
from pytriton.decorators import batch
@batch
def _infer_fn(sequences: np.ndarray):
sequences = np.char.decode(sequences.astype("bytes"), "utf-8")
sequences = sequences.squeeze(1).tolist()
embedding = MODEL.seq_to_embeddings(sequences)
response = {
"embedding": embedding.cpu().numpy(),
}
return response
where MODEL
is an instance of ESM1nvInference
class.
Now, define and start the server:
from pytriton.model_config import Tensor
from pytriton.triton import Triton
with Triton() as triton:
triton.bind(
model_name="ESM1",
infer_func=_infer_fn,
inputs=[
Tensor(name="sequences", dtype=bytes, shape=(1,)),
],
outputs=[
Tensor(name="embedding", dtype=np.float32, shape=(-1,)),
],
)
triton.serve()
Note
The expected shapes for the inputs and outputs are defined in _infer_fn
(without the batch dimension), where -1 denotes a dynamic size.
When the server is running, use the client to perform a query:
from pytriton.client import ModelClient
with ModelClient("localhost", "ESM1") as client:
result_dict = client.infer_batch(sequences)
Predefined Server-Client Scripts#
BioNeMo comes with a set of example scripts for inference with PyTriton.
These scripts utilize hydra configs available in the bionemo/examples/
directory to set up the model for inference. The three BioNeMo models are supported: MegaMolBART, ESM1 and ProtT5; and two inference modes: Sequence to Embedding (for all 3 models) and Sampling (for MegaMolBART)
Starting the Server#
To start the Triton Server (and send it to the background) run:
python bionemo/examples/triton/<embeddings,sampling>_server.py --config-path </path/to/dir/with/inference/config> &
You can start server for generating embeddings with MegaMolBART:
python bionemo/examples/triton/embeddings_server.py --config-path /workspace/bionemo/examples/molecule/megamolbart/conf &
For ESM1:
python bionemo/examples/triton/embeddings_server.py --config-path /workspace/bionemo/examples/protein/esm1nv/conf/ &
And for ProtT5:
python bionemo/examples/triton/embeddings_server.py --config-path /workspace/bionemo/examples/protein/prott5nv/conf/ &
Alternatively start server for sampling new sequences with MegaMolBART:
python bionemo/examples/triton/sampling_server.py --config-path /workspace/bionemo/examples/molecule/megamolbart/conf &
The scripts use hydra
and load model configuration from infer.yaml
present in the specified config directory, so custom configurations can be provided by specifying a different yaml file or overriding particular arguments.
Querying the Server#
Regardless of the model and server type selected, you can send a query with the general-purpose client script:
python bionemo/examples/triton/client.py --sequences SEQUENCES [SEQUENCES ...] [--output_path OUTPUT_PATH]
The only required argument is --sequences
, which should be a whitespace separated list of SMILES (for molecules) or FASTA (for protein) sequences.
Optionally, you can also provide --output_path
flag to save the pickled results in a specified file. If this argument is not given, the results will be printed.
For example:
python bionemo/examples/triton/client.py --sequences "CN1C=NC2=C1C(=O)N(C(=O)N2C)C" "c1ccccc1CC(O)=O"
if MegaMolBART was loaded by the server script, or:
python bionemo/examples/triton/client.py --sequences "MTADAHWIPVPTNVAYDALNPGAPGTLAFAAANGWQHHPLVTVQPLPGVVFRDAAGRSRFTQRAGD"
for one of the protein models, ESM1 or ProtT5.
To interact with a server set up in a different way (refer to Extending These Examples), provide the url with --url
flag (defaults to "localhost"
).
Closing the Server#
The server can be distbled by bringing it from the background (fg
) and killing it with ctrl+c
.
Extending These Examples#
Inference callable can contain any Python code. Extend the existing example with a custom post-processing or implement a more complex, multi-step inference pipeline.
For more control over inference parameters (for example, sampling strategy for MegaMolBART), they can be exposed to the user. Remember to represent all inputs and outputs to the inference callable as numpy arrays.
Use one of the provided components (server or client) alone - they are fully compatible with native solutions for Triton Inference Server.
Query the server with a different tool, like you would do with any other Triton instance
Yse the client to interact with any Triton server, not necessarily set up with PyTriton
Finally, PyTriton provides variety of options to customize the server. Refer to the PyTriton documentation.