Example of PyTriton Inference
Contents
Example of PyTriton Inference#
PyTriton provides a light-weight wrapper that allows you to set up the Triton Inference Server based on existing inference code. The only requirement is that inference is done by a function, that takes as an input and returns numpy arrays of supported types (numerical types or bytes).
Note that you should follow the instructions from the general BioNeMo PyTriton inference documentation first before proceeding with this detailed example.
Detailed Example with ESM-1nv#
In this example, the Sequence to Embedding task for ESM1 will be used as an example. The solution will consist of two components - server that performs the inference, and a client that queries this server.
The bionemo.model.protein.esm1nv.infer.ESM1nvInference class provides seq_to_embeddings method that can be used for this purpose. This method requires a list of FASTA sequences as input (list of strings) and returns a torch Tensor object as a result, so a converter must be implemented.
On the client side, a function that takes list of sequences as input and converts it into a numpy bytes array must be implemented:
import numpy as np
from bionemo.triton.utils import encode_str_batch
seqs = ['MSLKRKNIALIPAAGIGVRFGADKPKQYVEIGSKTVLEHVL', 'MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLA']
sequences: np.ndarray = encode_str_batch(seqs)
On the server side, an inference callable that performs the following must be implemented:
accepted input in a supported format (numpy bytes array)
decodes it to a list of strings
runs inference with the pre-trained BioNeMo model (for example, ESM1)
converts output to a supported format
and sends it back to the client
Mark this callable with the @batch decorator from PyTriton. This decorator converts the input request into a more suitable format that can be directly passed to the model (refer to more details on batch decorator in the PyTrtion documentation).
An example inference callable is provided below:
from typing import Dict
import numpy as np
from pytriton.decorators import batch
from bionemo.model.protein.esm1.infer import ESM1nvInference
from bionemo.triton.utils import decode_str_batch
# have this loaded in-memory already
# or load from a config with load_model_config and and use load_model_for_inference
# from the bionemo.triton.utils module to load the model
model: ESM1nvInference = ...
@batch
def infer_fn(sequences: np.ndarray) -> Dict[str, np.ndarray]:
seqs = decode_str_batch(sequences)
embedding = model.seq_to_embeddings(seqs)
response = {"embeddings": embedding.detach().cpu().numpy()}
return response
NOTE: This function is alreadty defined as triton_embedding_infer_fn in the bionemo.triton.embeddings module.
Now, define and start the server:
from pytriton.model_config import Tensor
from pytriton.triton import Triton
with Triton() as triton:
triton.bind(
model_name="ESM1",
infer_func=infer_fn,
inputs=[
Tensor(name="sequences", dtype=bytes, shape=(1,)),
],
outputs=[
Tensor(name="embeddings", dtype=np.float32, shape=(-1,)),
],
)
triton.serve()
NOTE: See the bionemo.triton.serve_bionemo_model script for more serious use. This bind and serve action is perfomed in the main function.
Note
The expected shapes for the inputs and outputs are defined in infer_fn (without the batch dimension), where -1 denotes a dynamic size.
If your shapes are incorrect, then Triton will fail to perform inference!
Warning
When using the @batch decorator, it is vital that the infer_fn parmaeter names align exactly with what is
deinfed for inputs to the .bind() call. These names are how PyTriton ensures that the right tensors are passed
along. Similiarly, the keys in the returned dictionary must align 1:1 with the names defined in the output tensors.
When the server is running, use the client to perform a query:
from pytriton.client import ModelClient
# you may use http://localhost:8000" or just "localhost" to use the HTTP interface
# this example uses the gRPC interface, which is faster and more network-efficient
with ModelClient("grpc://localhost:8001", "ESM1") as client:
result_dict = client.infer_batch(sequences)
embeddings = result_dict["embeddings"]
print(f"{embeddings.shape=}\n{embeddings}")"
Extending These Examples#
Inference callable can contain any Python code. Extend the existing example with a custom post-processing or implement a more complex, multi-step inference pipeline.
For more control over inference parameters (for example, sampling strategy for MegaMolBART), they can be exposed to the user. Remember to represent all inputs and outputs to the inference callable as numpy arrays.
Use one of the provided components (server or client) alone - they are fully compatible with native solutions for Triton Inference Server.
Query the server with a different tool, like you would do with any other Triton instance
Use the client to interact with any Triton server, not necessarily set up with PyTriton
Finally, PyTriton provides variety of options to customize the server. Refer to the PyTriton documentation.